DPCfam | MC215960
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 62 ± 8 aa |
| Residues in low-complexity regions (%) | 1.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08045 |
| Sequences matching dominant architecture (%) | 98.06 |
| Average overlap percent | 48.83 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A120E5U0 | 186-247 | 62 | LALVVLDTLLCGLVDQPKNMRTFESAGGLGAIREVPALMSPSDGIYRIKVIEMLFFYLMPEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CAH2-F1 | 152-215 | 96.97 | 95.35 | View in AlphaFoldDB ↗ |