DPCfam | MC215726
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 843 ± 104 aa |
| Residues in low-complexity regions (%) | 1.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.03 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1R3IZN7 | 760-1702 | 943 | AIPAVSSPLTKGNTFLLLDWIQYMKRNRIIIPEKFLTSIKNGSWLKVTINGSSTYKPPSQSFFYTSSWGNILQNGSEFVDIPLID... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A096TM19-F1 | 760-1690 | 99.89 | 81.96 | View in AlphaFoldDB ↗ |