DPCfam | MC215638
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Residues in low-complexity regions (%) | 1.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.06 |
| Average transmembrane regions | 0.9 |
| Dominant Pfam architecture(s) | PF12234 |
| Sequences matching dominant architecture (%) | 0.81 |
| Average overlap percent | 10.65 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A016S1Q5 | 2264-2361 | 98 | TRTYTLNDGVKVTTPPSRWPGVDNLVALLSREKDDEAPHLRQLLAECFVAITMSLFCFALAVYDSRWLYRLAAHQMDAVQFSLIF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7FPV9-F1 | 642-726 | 92.39 | 78.48 | View in AlphaFoldDB ↗ |