DPCfam | MC215441
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.72 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01008 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 28.3 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C3LJF6 | 179-243 | 65 | LIDAIKDVIDELETVYDGVAKNARDHIHADEIILTIGKSRTVEAFLKSAAHYRKFTVIVAETAPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q99LD9-F1 | 129-197 | 98.57 | 93.20 | View in AlphaFoldDB ↗ |