DPCfam | MC215351
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 528 ± 80 aa |
| Residues in low-complexity regions (%) | 1.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.07 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF02485- PF12529 |
| Sequences matching dominant architecture (%) | 80.95 |
| Average overlap percent | 70.59 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7TLH6 | 242-809 | 568 | FSNIAIADERYSSIWGGASLLTMHLACMQALLKKTEWNWDYFINLSESDFPIKTIPQLLAYLTHNPERNFLKSHGKDTYRFIRKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q86Y38-F1 | 372-948 | 99.82 | 96.29 | View in AlphaFoldDB ↗ |