DPCfam | MC215233
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Residues in low-complexity regions (%) | 0.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02900 |
| Sequences matching dominant architecture (%) | 98.0 |
| Average overlap percent | 26.17 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B1Y5Q7 | 1-75 | 75 | MADIIGGVVTSHVPAIGRAIAKNLQADPYWAPFFEGYAPLHRWIEKSKPDVVVVIYNDHGLNFFLDKMPTFAVGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3H4Q3-F1 | 1-67 | 100.00 | 97.07 | View in AlphaFoldDB ↗ |