DPCfam | MC215081
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Residues in low-complexity regions (%) | 6.28 |
| Residues in coiled-coil regions (%) | 0.25 |
| Predicted disordered residues (%) | 5.29 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q22WA3 | 694-779 | 86 | IQKKQKFSFSLKHYIMMVFCNKKMKNESAAKMKYGIKSIQKQLDIIYIISKLQEIDKLKSVILDEDQLKLFNNISKPILSGKQKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O00844-F1 | 400-486 | 96.55 | 82.05 | View in AlphaFoldDB ↗ |