DPCfam | MC215063
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 125 ± 19 aa |
| Residues in low-complexity regions (%) | 2.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01446 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 56.52 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009B2B290 | 76-195 | 120 | LIAVNKSYFKDTKAYISQKEWLEMWRDVTGNSEITQVHIQKVKQNNNKELYEMAKYSGKDNDYLINQKVFDAFYKALKGKQVLVY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0A0C3-F1 | 90-215 | 96.03 | 81.55 | View in AlphaFoldDB ↗ |