DPCfam | MC214946
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Residues in low-complexity regions (%) | 1.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00370- PF02782 |
| Sequences matching dominant architecture (%) | 56.79 |
| Average overlap percent | 23.54 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M3IKP2 | 274-359 | 86 | TYEATGKISQYFVDTYGFSPKTKIYSFTGDNLATILSLPLQPNDCLISLGTSTTVLIITSNYQPSSQYHLFKHPSLPKHYMGMLC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3SYZ6-F1 | 254-336 | 98.81 | 97.25 | View in AlphaFoldDB ↗ |