DPCfam | MC214860
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 68 ± 7 aa |
| Residues in low-complexity regions (%) | 0.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02760 |
| Sequences matching dominant architecture (%) | 92.16 |
| Average overlap percent | 25.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L8Y2Y1 | 248-311 | 64 | KTEQKNSVLFDLSDNTGRMEVLVPGKQNKIECEEGDKLRLTFLELARNGEKLQLKFGAHSDIKV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0DOV2-F1 | 346-413 | 98.55 | 94.83 | View in AlphaFoldDB ↗ |