DPCfam | MC214789
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 107 ± 14 aa |
| Residues in low-complexity regions (%) | 3.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13855 |
| Sequences matching dominant architecture (%) | 17.14 |
| Average overlap percent | 15.76 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L8E5M8 | 187-287 | 101 | RIATLPVELRQMTSLVDLALDSNPLTSPPASLCVRGMVHVFKYLETMAVREGRNIVDGNTTLRRSAVSQSMRNTSTTEKRRVDSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4I9F0-F1 | 218-321 | 99.10 | 63.85 | View in AlphaFoldDB ↗ |