DPCfam | MC214710
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Residues in low-complexity regions (%) | 0.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00073FE0F6 | 476-535 | 60 | DDKDVLPPLPHIPQSFVGKTWSQVMHEDDLKIEALVREFREGHFRCYFDSESLAKFGRKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HCK1-F1 | 1812-1871 | 93.75 | 70.78 | View in AlphaFoldDB ↗ |