DPCfam | MC214668
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 408 ± 42 aa |
| Residues in low-complexity regions (%) | 1.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.26 |
| Average transmembrane regions | 0.13 |
| Dominant Pfam architecture(s) | PF00392- PF07085- PF00571- PF00571 |
| Sequences matching dominant architecture (%) | 28.26 |
| Average overlap percent | 72.16 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C5NXH2 | 3-416 | 414 | SKHQKILEYIKSLPIGSKISVRQVAKELKVSEGTAYRAIKESENRGFVSSIERVGTVRIQKKERDNVEKLSYSEIVNIVSGQLIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34921-F1 | 3-421 | 99.29 | 89.37 | View in AlphaFoldDB ↗ |