DPCfam | MC214653
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 148 ± 25 aa |
| Residues in low-complexity regions (%) | 2.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.12 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02666 |
| Sequences matching dominant architecture (%) | 16.13 |
| Average overlap percent | 2.28 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B0TT31 | 5-145 | 141 | TSIVRNLKHIIESKQEYRLELIKCIEKAEWIPPYSDTAISNLDGFYEYLDKMLVTTPADSTFSDLFHGIYFIISQGSNKFQKDPN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2F9L4-F1 | 36-166 | 84.35 | 91.87 | View in AlphaFoldDB ↗ |