DPCfam | MC21449
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 756 ± 88 aa |
| Residues in low-complexity regions (%) | 7.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02752 |
| Sequences matching dominant architecture (%) | 67.35 |
| Average overlap percent | 37.93 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I2H8Q2 | 156-897 | 742 | TYGDKYLAKYLKRRGFLPQKHILSGNEMTISFAATGNQVFLPTQSTQADEYLADVTGTHHHDFDSEEDDLDQLEESSVINDSILL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P38167-F1 | 195-964 | 99.60 | 71.03 | View in AlphaFoldDB ↗ |