DPCfam | MC214265
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Residues in low-complexity regions (%) | 0.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00350 |
| Sequences matching dominant architecture (%) | 56.82 |
| Average overlap percent | 4.84 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7UA39 | 51-123 | 73 | ESQIRIILNKADSLVPQELMRVYGALFWSMAPLINVTEPPRVYVGSFWPYAYGPDTSHELFKREEISLLEDLN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8T8W3-F1 | 210-279 | 98.59 | 89.39 | View in AlphaFoldDB ↗ |