DPCfam | MC214243
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 166 ± 17 aa |
| Residues in low-complexity regions (%) | 5.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11863 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 38.02 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V5TXE4 | 1-167 | 167 | MSTIPLSVDFNITPNVVTPAGSALDANGLMLTDNELIPVGTVATYSTAADVSALMGSTSKEFLAAQQYFNGYENSSVIPGQLLMY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GPA9-F1 | 1-171 | 99.43 | 89.97 | View in AlphaFoldDB ↗ |