DPCfam | MC214190
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 264 ± 36 aa |
| Residues in low-complexity regions (%) | 3.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13505 |
| Sequences matching dominant architecture (%) | 51.22 |
| Average overlap percent | 69.93 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5B5K9 | 26-253 | 227 | DEVKFDATYFSLGNGVYANVSWGHLINKNVSFELGLGYEYGIKIKRMEIQTNSPDSITDQMFSYQSKMFYICPSLVFKTDFEKIN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q83C69-F1 | 39-156 | 47.33 | 90.76 | View in AlphaFoldDB ↗ |