DPCfam | MC214060
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 127 ± 18 aa |
| Residues in low-complexity regions (%) | 8.77 |
| Residues in coiled-coil regions (%) | 61.08 |
| Predicted disordered residues (%) | 51.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B7N084 | 693-808 | 116 | KKDFENRESRWTSHTTMMEDRFDHLLDNFDKLTNSAIEFDSHRMRYDKRIENLHQNISNLELELYDEKLKRIGYSAGHEQAPTTV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NJT5-F1 | 667-792 | 97.69 | 78.21 | View in AlphaFoldDB ↗ |