DPCfam | MC214052
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 1400 ± 282 aa |
| Residues in low-complexity regions (%) | 6.08 |
| Residues in coiled-coil regions (%) | 32.2 |
| Predicted disordered residues (%) | 36.73 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF08913- PF01608 |
| Sequences matching dominant architecture (%) | 51.81 |
| Average overlap percent | 46.78 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B7QM86 | 1164-2604 | 1441 | MAQLLTAASQGNESYTGTAARDTASALKQLTGAVRGVAATSGDSALQTRLVDHAREVLDRSCQLLEEARQAVLRPDDPDKQQRLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P54939-F1 | 822-2529 | 100.00 | 78.38 | View in AlphaFoldDB ↗ |