DPCfam | MC213915
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Residues in low-complexity regions (%) | 3.5 |
| Residues in coiled-coil regions (%) | 1.27 |
| Predicted disordered residues (%) | 25.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17167 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 15.32 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H5Y361 | 2558-2625 | 68 | LYTILEGFAELCARGKAGDMDIALRYRQVAQELARNLNENAWDGQWYRRAYFDNGQPLGSELNQECRI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B9K7M6-F1 | 525-585 | 92.42 | 98.42 | View in AlphaFoldDB ↗ |