DPCfam | MC213817
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 214 ± 36 aa |
| Residues in low-complexity regions (%) | 8.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.71 |
| Average transmembrane regions | 3.54 |
| Dominant Pfam architecture(s) | PF07950 |
| Sequences matching dominant architecture (%) | 39.88 |
| Average overlap percent | 36.09 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V8TH20 | 62-284 | 223 | SGNSHTPIYYLLRLQKFSSLTFLAFATAHITNTSLIPLLTQSVPASEPYLLLTRPYYQSWPIAEPLLIIAPLVVHVASGVGLRLY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WHI6-F1 | 70-299 | 98.57 | 90.35 | View in AlphaFoldDB ↗ |