DPCfam | MC213636
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 336 ± 22 aa |
| Residues in low-complexity regions (%) | 2.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.07 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF07388 |
| Sequences matching dominant architecture (%) | 30.23 |
| Average overlap percent | 79.62 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7IWU1 | 4-332 | 329 | KNLFLVNTPYQLMLVINMVLEVFNKEENDIIITNRIADNSKLGKRLENSGIFEKVFLINIDEEIRENDVFHIFKERLIPSKFKYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1A6Z508-F1 | 4-318 | 96.47 | 92.84 | View in AlphaFoldDB ↗ |