DPCfam | MC213347
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 162 ± 11 aa |
| Residues in low-complexity regions (%) | 5.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.86 |
| Average transmembrane regions | 3.64 |
| Dominant Pfam architecture(s) | PF03729 |
| Sequences matching dominant architecture (%) | 1.49 |
| Average overlap percent | 29.56 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000367B5C4 | 36-177 | 142 | GFIVLLIGCFRLTKHGKAQQMFRYYAPSTTFFMIFSGVILVSITNFFQMLTASLFPITSLNPQNTLLRYMNDFSNISTNQQTVYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZH05-F1 | 638-799 | 98.77 | 79.50 | View in AlphaFoldDB ↗ |