DPCfam | MC213318
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Residues in low-complexity regions (%) | 0.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02812 |
| Sequences matching dominant architecture (%) | 84.0 |
| Average overlap percent | 13.0 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A167YAS3 | 59-124 | 66 | PSEPEFQQAYNELASTLENSSLFQKHPEYKTALEVVSIPERVIQFRVVWEDDKGQVRVNRGYRVQF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P14657-F1 | 10-78 | 98.57 | 95.60 | View in AlphaFoldDB ↗ |