DPCfam | MC21324
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 164 ± 24 aa |
| Residues in low-complexity regions (%) | 2.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.67 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08772 |
| Sequences matching dominant architecture (%) | 93.29 |
| Average overlap percent | 43.33 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E9E5H9 | 214-414 | 201 | PETQQDSDDEGWITPSNLKRHQAADSAGSTPPAAPAGAKDAAGGHPHVRLRHAKRRPPHQHQPRHAVLLAHHPPQELGAPLPRLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I3ISV3-F1 | 236-402 | 99.41 | 89.19 | View in AlphaFoldDB ↗ |