DPCfam | MC212731
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 95 ± 8 aa |
| Residues in low-complexity regions (%) | 2.14 |
| Residues in coiled-coil regions (%) | 1.03 |
| Predicted disordered residues (%) | 19.53 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF12833 |
| Sequences matching dominant architecture (%) | 97.75 |
| Average overlap percent | 6.83 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K9XEA0 | 165-263 | 99 | IKPYYRLGITTPEMEVVLHQILHCPYQGLSKRMYLEGKALELLTLQFSQFVQGDRISQSSVLRSDDIERIHYAREILLARLHDPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P40883-F1 | 141-230 | 95.74 | 88.11 | View in AlphaFoldDB ↗ |