DPCfam | MC212717
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Residues in low-complexity regions (%) | 10.28 |
| Residues in coiled-coil regions (%) | 0.14 |
| Predicted disordered residues (%) | 1.46 |
| Average transmembrane regions | 2.79 |
| Dominant Pfam architecture(s) | PF14348 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 66.89 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E5B3F5 | 16-101 | 85 | LPALKTRVAIGLVGDLVCQDLRRFGADHESGFVYHHARRILGSSQAATGLVWLAVPIFLEPAYVLMPGVVGMGLAISIAAFKKHV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3H308-F1 | 112-215 | 99.05 | 84.79 | View in AlphaFoldDB ↗ |