DPCfam | MC212394
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 238 ± 27 aa |
| Residues in low-complexity regions (%) | 13.49 |
| Residues in coiled-coil regions (%) | 0.32 |
| Predicted disordered residues (%) | 61.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2LS65 | 20-282 | 263 | GELKVYRAGSSEGKIPVPSNLRKQRSMTNLAILTDAEKKLHLYEPKWCDDIAKTGAGQSKMSKPKTAGGGSSAGGGVHLSRNLSK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8NEY1-F1 | 62-288 | 99.56 | 42.97 | View in AlphaFoldDB ↗ |