DPCfam | MC212365
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 156 ± 22 aa |
| Residues in low-complexity regions (%) | 2.94 |
| Residues in coiled-coil regions (%) | 0.9 |
| Predicted disordered residues (%) | 12.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02151 |
| Sequences matching dominant architecture (%) | 3.03 |
| Average overlap percent | 7.18 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P5HGP8 | 277-434 | 158 | SIFNFLRGSENLVTIDTLKPEVALYWCTAVGFLHSEGVHAADALETIMPEMTAFGKYVKDFVIAKLSETDEMEVLSMEFTVGKLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1Z987-F1 | 366-506 | 96.05 | 91.20 | View in AlphaFoldDB ↗ |