DPCfam | MC212346
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Residues in low-complexity regions (%) | 3.36 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 4.85 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF10181 |
| Sequences matching dominant architecture (%) | 97.2 |
| Average overlap percent | 68.69 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L2GE48 | 130-225 | 96 | AYATLLRTHKTESLLVLRGLGIQTSSSSGSYLYAAATRFIPTEKIQDVLVNEAFKGFEVRYYLIVIVEGEEDLVVVFPQILPRKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NKX0-F1 | 103-200 | 98.02 | 93.07 | View in AlphaFoldDB ↗ |