DPCfam | MC212295
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Residues in low-complexity regions (%) | 0.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05694 |
| Sequences matching dominant architecture (%) | 96.05 |
| Average overlap percent | 25.16 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I7SL85 | 171-239 | 69 | NEGNRKCDMILLDSKTFEVKRSWCKVPSNVPAPKFHYDFWYQPKFNVLLSTEWGTPNNIKKGFNPADVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8VIF7-F1 | 157-222 | 98.51 | 97.08 | View in AlphaFoldDB ↗ |