DPCfam | MC212293
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1191 |
|---|---|
| Mean domain length (aa) | 485 ± 118 aa |
| Residues in low-complexity regions (%) | 3.29 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 20.05 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF00888- PF10557 |
| Sequences matching dominant architecture (%) | 67.84 |
| Average overlap percent | 79.01 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1WYU3 | 315-914 | 599 | RFLGGVFKLYENDRKGEADLDNSNLLMASIRILSNLGLYSSLFEPRFIDVSEGYYRLLAEEEADADDVARYARQCSSQIQKEIER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B2RYJ3-F1 | 234-758 | 100.00 | 92.24 | View in AlphaFoldDB ↗ |