DPCfam | MC211885
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Residues in low-complexity regions (%) | 1.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01841 |
| Sequences matching dominant architecture (%) | 3.6 |
| Average overlap percent | 14.54 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A8J397 | 30-118 | 89 | PESYRINSPAETRLVTLAENFQLQYSRQYPDRRPLLLCPLNECGVRKFVSTTIRPTPTGRCGLQTWQGCAALVADLLMLEPLDPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q95JL1-F1 | 77-165 | 96.74 | 92.25 | View in AlphaFoldDB ↗ |