DPCfam | MC211790
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 133 ± 21 aa |
| Residues in low-complexity regions (%) | 7.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 47.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15386 |
| Sequences matching dominant architecture (%) | 94.03 |
| Average overlap percent | 42.5 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L9KU52 | 397-504 | 108 | RLNKKEFSLEEIYTNKNYQSPTTRRTFETIFEEPRERNGTLIFTSSKKLRRAVEFRDSSLPRCRRPSRGVRAATGKALTPNLAPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7EYB5-F1 | 910-1060 | 99.23 | 67.92 | View in AlphaFoldDB ↗ |