DPCfam | MC211500
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 244 ± 49 aa |
| Residues in low-complexity regions (%) | 5.44 |
| Residues in coiled-coil regions (%) | 8.86 |
| Predicted disordered residues (%) | 34.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03344 |
| Sequences matching dominant architecture (%) | 16.92 |
| Average overlap percent | 9.54 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005235BE3 | 2-144 | 142 | MGEIRRLQEKELDLAELDSEDSSYLQESRLKRRMMRIFQRLCQLKRCSSLTGRVIEQRITYRGTRYPEVNRRIERFINRPEAFPD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1LUU4-F1 | 182-398 | 98.61 | 92.82 | View in AlphaFoldDB ↗ |