DPCfam | MC211195
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 299 ± 29 aa |
| Residues in low-complexity regions (%) | 0.98 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 11.21 |
| Average transmembrane regions | 0.15 |
| Dominant Pfam architecture(s) | PF09462 |
| Sequences matching dominant architecture (%) | 97.63 |
| Average overlap percent | 44.18 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D2PCP1 | 1302-1634 | 333 | EASHYASELWVCLIHVYTTYLPQEVAAKPQTHPLWPVLLEALRLHVDKEILEPAAASETAWFTIYSLCALSQFSAHGTTIGLPRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VVE2-F1 | 1163-1467 | 99.67 | 88.01 | View in AlphaFoldDB ↗ |