DPCfam | MC211137
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 122 ± 21 aa |
| Residues in low-complexity regions (%) | 3.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.79 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF16046 |
| Sequences matching dominant architecture (%) | 90.48 |
| Average overlap percent | 60.72 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1LX32 | 25-144 | 120 | QQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6PBM7-F1 | 25-144 | 99.19 | 90.80 | View in AlphaFoldDB ↗ |