DPCfam | MC210950
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 107 ± 14 aa |
| Residues in low-complexity regions (%) | 1.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03714 |
| Sequences matching dominant architecture (%) | 93.21 |
| Average overlap percent | 89.21 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A017T1F1 | 139-247 | 109 | TEAPAVPAEDTAIVYYRRPDDGYDDWGLHLWGDTATPTDWSAPVLASGEDSYGAWYEVPLAENAAQVNFIIHQGDAKDPGPDQAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O33840-F1 | 20-120 | 98.08 | 92.68 | View in AlphaFoldDB ↗ |