DPCfam | MC210825
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 188 ± 20 aa |
| Residues in low-complexity regions (%) | 3.57 |
| Residues in coiled-coil regions (%) | 1.53 |
| Predicted disordered residues (%) | 1.29 |
| Average transmembrane regions | 5.63 |
| Dominant Pfam architecture(s) | PF01494 |
| Sequences matching dominant architecture (%) | 0.6 |
| Average overlap percent | 3.96 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L9ST23 | 290-488 | 199 | IADTCKLLMGVGWTINYIGMISKSLKDRTYAMSIMALCCNFAWEITYAFIYPFGSHLERCVHYSGLLLNCGVMYTAIKNAPREWA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1B7YCX1-F1 | 25-220 | 98.43 | 94.68 | View in AlphaFoldDB ↗ |