DPCfam | MC210805
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Residues in low-complexity regions (%) | 3.3 |
| Residues in coiled-coil regions (%) | 5.52 |
| Predicted disordered residues (%) | 26.04 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03790- PF03791 |
| Sequences matching dominant architecture (%) | 85.37 |
| Average overlap percent | 94.11 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009AAB8C0 | 196-294 | 99 | SEIIKAKIMSHPLYPAIFRAFIDCRKVRAPLEIIGRLSALVDDVEMNSDDRQEQRRAADPELDQFMEIYCHMLVRYRQELTRPIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O65034-F1 | 86-186 | 98.13 | 87.15 | View in AlphaFoldDB ↗ |