DPCfam | MC210749
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 103 ± 17 aa |
| Residues in low-complexity regions (%) | 1.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03837 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 39.87 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S8NX74 | 16-150 | 135 | QSTVNVQETIFKNLINSDEIKSKFTEVLKDKAFEYINSVINLVKETPTPNVLGASDSHQSIDLGSLLIECEPKSIIDACMIAASL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45908-F1 | 27-132 | 97.41 | 94.89 | View in AlphaFoldDB ↗ |