DPCfam | MC210721
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 220 ± 52 aa |
| Residues in low-complexity regions (%) | 17.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 65.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05182 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 19.48 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F2QWQ8 | 2-189 | 188 | DEDDEYLYGSDDEQPQQIGAPETKTASSEKSSTAVKTETGPVSDDEDDNDNSDYSDSDSDIDIVIGALEPSTQPAASTTASSAVP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6BGR9-F1 | 5-208 | 94.29 | 56.92 | View in AlphaFoldDB ↗ |