DPCfam | MC210590
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Residues in low-complexity regions (%) | 4.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10905 |
| Sequences matching dominant architecture (%) | 95.24 |
| Average overlap percent | 63.93 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006DBF747 | 130-205 | 76 | QEAFMAALPMDLVEFEEMFDYLQASLEQNPCDMKFTITRKFLSERGLDEDAIVSFLFQEGGHCDCEVLMNVSMQFP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P64968-F1 | 20-94 | 97.44 | 97.78 | View in AlphaFoldDB ↗ |