DPCfam | MC209995
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 131 ± 24 aa |
| Residues in low-complexity regions (%) | 5.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.31 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF11711 |
| Sequences matching dominant architecture (%) | 97.06 |
| Average overlap percent | 36.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B1P7W3 | 269-421 | 153 | LPRPYFNTHRYFMSPLLEDIPSELEPSVPISFPHLLGFLNTPKRIYRFLNRRKLADSIGREIAAAILSSYRPYHIFEDLEPSELS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2UJY4-F1 | 236-384 | 99.16 | 82.30 | View in AlphaFoldDB ↗ |