DPCfam | MC209338
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 406 ± 54 aa |
| Residues in low-complexity regions (%) | 17.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 62.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00250- PF16675- PF16676 |
| Sequences matching dominant architecture (%) | 56.25 |
| Average overlap percent | 86.83 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F1R3E6 | 172-627 | 455 | MLNPEGGKTGKAHRRRATSMDNSGKLLKSRIRAKQTKKQAGAAGIGGTGGGLQGEGTSGTGNADSPGPPGQFGKWGVNSSSPSSR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O43524-F1 | 208-672 | 100.00 | 46.35 | View in AlphaFoldDB ↗ |