DPCfam | MC20923
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Residues in low-complexity regions (%) | 2.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.52 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF15094 |
| Sequences matching dominant architecture (%) | 2.94 |
| Average overlap percent | 8.6 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00072EA741 | 152-258 | 107 | SGLSSDSSPYFSEWEAMRPVVECADDVMTLTLSGRGFIHLQVDRNRASPISIFQLPSDCGYSVKASWTDLEMMVPYDGCYIVKEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8RT68-F1 | 79-176 | 91.59 | 85.77 | View in AlphaFoldDB ↗ |