DPCfam | MC209211
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 58 ± 8 aa |
| Residues in low-complexity regions (%) | 1.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.55 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11308 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 22.2 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F2XLI3 | 278-342 | 65 | WGDGRTIPALNQLKSLGIKRLWLGYEDKPPHLYTDKWMKEQHYVDEDYIRTAKAFGYLVGPYDSF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ENQ5-F1 | 283-338 | 98.28 | 95.63 | View in AlphaFoldDB ↗ |