DPCfam | MC209210
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 72 ± 10 aa |
| Residues in low-complexity regions (%) | 0.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 58.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146ZII6 | 1749-1825 | 77 | TFCVGAENEPDGGPEDWLRIAELQARNKACLPHLKSSYPVESETGQGSALTFTDEELRTGDPSDTIRRASMMPGQLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9Q7G0-F1 | 1888-1959 | 96.00 | 43.18 | View in AlphaFoldDB ↗ |