DPCfam | MC209054
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Residues in low-complexity regions (%) | 6.89 |
| Residues in coiled-coil regions (%) | 12.29 |
| Predicted disordered residues (%) | 18.86 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF01044 |
| Sequences matching dominant architecture (%) | 93.41 |
| Average overlap percent | 40.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4XV47 | 30-107 | 78 | AGKGNMVRAARGLLSAITRVLLMADKIVIKQISQSRNRVSNSLERIDKTRSFTEFVQCFSQFGREMVELAHLTGDRQI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1LU92-F1 | 103-198 | 92.71 | 85.35 | View in AlphaFoldDB ↗ |